You are here

Unsolved

The problem hasn't been solved

Segmentation Fault during prepacking

Category: 
Docking

Dear all,

   When I do prepack of a antibody-antigen complex with the following command,

mpirun -np 6 docking_prepack_protocol.mpi.linuxgccrelease\
  -in:file:s nb0-ag-start.pdb\
  -ex1\
  -ex2\
  -partners H_A\
  -ensemble1 nb_ensemble.list\
  -ensemble2 ag_ensemble.list\
  -docking:dock_rtmin\
  -out:path:all prepacking
 

I always get a "segmentation Fault" like the following: 

[END_BACKTRACE]

Post Situation: 

reading of AtomPair failed in relax with constraint

Category: 
Constraints

Hello,

I am relaxing a protein with a chemically bound ligand (attach as C14_SPF). The ligand is composed of Phosphopantethine and acyl together which are bound to ALA (residue 36 of chain B) of my protein. Actually, the residue 36 was originally SER which is bound to Phosphopantethine and acyl, but for modeling I took the OG of SERin Phosphopantethine and converted SER to ALA.

Post Situation: 

Interface Analyzer with Glycans

Category: 
Scoring

Hello all, 

            Is it possible to run InterfaceAnalyzer with a structure with Glycans? Everytime I apply the InterfaceAnalyzerMover on my structure I get a segmentation fault. If I just delete the carbohydrates it works just fine. The pose has been processed with all of the usual flags(below). Is there some trick to using glycans and InterfaceAnalyzerMover or can someone point me in the right direction? Thanks so much.

                                                                                                        Drew

Post Situation: 

Difference between interface_delta_X and dG_separated?

Category: 
Design

Hi, everyone!

I am using RosettaLigand design protocol to design some mutants, in order to improve binding affinity to a small molecule. When I was using InterfaceAnalyzer, there were 2 values representing binding affinity, interface_delta_X and dG_separated. I want to know the difference between these 2 values and which one I can use during the filter process.

Any suggestion will be appreciated!

Nicole

Post Situation: 

Error in building fragment_picker with boost_thread

Category: 
Compilation

Hi all,

I am new to the whole Rosetta community and am asking for some help in compiling Rosetta3.  I have downloaded build Rosetta3.12 build 2020.08.61146 and tried to compile the thread boost version of fragment pick by using

./scons.py mode=release extras=boost_thread bin/fragment_picker.boost_thread.linuxgccrelease -j 20

The error message that I get is:

**************************************************

Post Situation: 

"Residue 7 was disulfide bonded but had no partner" with antibody.linuxgccrelease

Category: 
Structure prediction

Dear all,

I am trying to modeling a camelid antibody with the sequence (nb.fasta) as following:

$cat nb.fasta

>heavy
QVQLQESGGGLVQAGGSLRLSCAASGTIFETEGMGWYRQAPGKEREFVATIGGGSITYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVIAFTEHKYSYWGQGTQVTVSSLE

 

I use antibody.linuxgccrelease to model it:

Post Situation: 

adding greek_alphabets in non-canonical AA parameter generation

Category: 
Non-Canonical Peptides

Hello

I am running molfile_to_params_polymer.py to get the .params file for my non-canonical aa. But I got the error below. I think it might be due to the long chain of my non-canonical amino acid. I tried to increase the greek letters list in line 1655 of the script, but it did not work. Maybe it needs to modiy several lines of code.

Also, I got large numbers (as you see the error below).Can someone help to modify the code for my non-canonical  amino acid to resolve the error?

Post Situation: 

Colab Install Help

Category: 
Compilation

I'm trying to install Pyrosetta using Colab with the workshop notebooks but I keep getting errors. The main error is locating the tar file in My Drive. The code I'm running is: 

#sys.path.insert(0, google_drive_packages_path)

 

# installing PyRosetta

if sys.version_info.major != 3 or sys.version_info.minor != 6:

    print('Need Python-3.6 to run!')

    sys.exit(1)

 

import_start_time = time.time()

 

Post Situation: 

Pages