This historical page is locked! For new posts see Github Discussions.

You are here

Error running Abinitio relax with @flags

8 posts / 0 new
Last post
Error running Abinitio relax with @flags
#1

Dear Rosetta user's,

I'd tried to run an abinitio fast relax employing the option @data with my system as it was pointed by documentation (https://www.rosettacommons.org/docs/latest/rosetta_basics/running-rosetta-with-options#running-rosetta-via-mpi) and the program gave me this error message [1]. Afterwards, I tried to run again (explicitly defining at the command line the same options that I'd included at my data file) and Rosetta run fine [2]. Until now I'm wondering what wrong I'd made with my data file that I couldn't to run abinitio fast relax through @data option. Anyone could help me with this error?

Regards.

[1] samuel@jaguatirica:~/Lais/n$ AbinitioRelax.linuxgccrelease @data
core.init: Rosetta version exported  from http://www.rosettacommons.org
core.init: command: AbinitioRelax.linuxgccrelease @data
core.init: 'RNG device' seed mode, using '/dev/urandom', seed=1118337764 seed_offset=0 real_seed=1118337764
core.init.random: RandomGenerator:init: Normal mode, seed=1118337764 RG_type=mt19937
core.init: found database environment variable ROSETTA3_DB: /home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/database

ERROR: Error: can't read sequence! Use -in::file::fasta sequence.fasta or -in::file::native native.pdb!
ERROR:: Exit from: src/protocols/abinitio/AbrelaxApplication.cc line: 490
/home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/source/build/src/release/linux/3.2/64/x86/gcc/4.6/default/libutility.so(print_backtrace()+0x1e) [0x2ba754f5bd1e]
/home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/source/build/src/release/linux/3.2/64/x86/gcc/4.6/default/libutility.so(utility::exit(std::string const&, int, std::string const&, int)+0xb9) [0x2ba754f5ba99]
/home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/source/build/src/release/linux/3.2/64/x86/gcc/4.6/default/libprotocols_b.5.so(protocols::abinitio::AbrelaxApplication::setup()+0x163f) [0x2ba75367c8bf]
/home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/source/build/src/release/linux/3.2/64/x86/gcc/4.6/default/libprotocols_b.5.so(protocols::abinitio::AbrelaxApplication::run()+0x199) [0x2ba7536966f9]
AbinitioRelax.linuxgccrelease() [0x401f0a]
/lib/x86_64-linux-gnu/libc.so.6(__libc_start_main+0xed) [0x2ba75573476d]
AbinitioRelax.linuxgccrelease() [0x402175]
Exception :

[ERROR] EXCN_utility_exit has been thrown from: src/protocols/abinitio/AbrelaxApplication.cc line: 490
ERROR: Error: can't read sequence! Use -in::file::fasta sequence.fasta or -in::file::native native.pdb!

protocols::checkpoint: Deleting checkpoints of Abrelax

[2] samuel@jaguatirica:~/Lais/n$ AbinitioRelax.linuxgccrelease -database /home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/database -in::file::fasta /home/samuel/Lais/n/t000_.fasta -in::file::frag3 /home/samuel/Lais/n/aat000_03_05.200_v1_3 -in::file::frag9 /home/samuel/Lais/n/aat000_09_05.200_v1_3 -abinitio:relax -relax:fast -use_filters true -out:file:silent bamil13_10.out -nstruct 10 -constant_seed -jran 1234567 -psipred_ss2 /home/samuel/Lais/n/t000_.psipred -abinitio::increase_cycles 10 -abinitio::rsd_wt_helix 0.7 -abinitio::rg_reweight 0.5 -seed_offset 10
core.init: Rosetta version exported  from http://www.rosettacommons.org
core.init: command: AbinitioRelax.linuxgccrelease -database /home/tacio/Install/rosetta_src_2015.05.57576_bundle/main/database -in::file::fasta /home/samuel/Lais/n/t000_.fasta -in::file::frag3 /home/samuel/Lais/n/aat000_03_05.200_v1_3 -in::file::frag9 /home/samuel/Lais/n/aat000_09_05.200_v1_3 -abinitio:relax -relax:fast -use_filters true -out:file:silent bamil13_10.out -nstruct 10 -constant_seed -jran 1234567 -psipred_ss2 /home/samuel/Lais/n/t000_.psipred -abinitio::increase_cycles 10 -abinitio::rsd_wt_helix 0.7 -abinitio::rg_reweight 0.5 -seed_offset 10
core.init: Constant seed mode, seed=1234567 seed_offset=10 real_seed=1234577
core.init.random: RandomGenerator:init: Normal mode, seed=1234577 RG_type=mt19937
protocols.abinitio.AbrelaxApplication: read fasta sequence: 42 residues
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIT
protocols.evaluation.ChiWellRmsdEvaluatorCreator: Evaluation Creator active ...
core.chemical.ResidueTypeSet: Finished initializing centroid residue type set.  Created 1042 residue types
core.io.fragments: reading fragments from file: /home/samuel/Lais/n/aat000_09_05.200_v1_3 ...
core.io.fragments: rosetta++ fileformat detected! Calling legacy reader...
core.fragments.ConstantLengthFragSet: finished reading top 25 9mer fragments from file /home/samuel/Lais/n/aat000_09_05.200_v1_3
core.io.fragments: reading fragments from file: /home/samuel/Lais/n/aat000_03_05.200_v1_3 ...
core.io.fragments: rosetta++ fileformat detected! Calling legacy reader...
core.fragments.ConstantLengthFragSet: finished reading top 200 3mer fragments from file /home/samuel/Lais/n/aat000_03_05.200_v1_3
core.fragment: compute strand/loop fractions for 42 residues...
protocols.abinitio.AbrelaxApplication: run ClassicAbinitio.....
basic.io.database: Database file opened: scoring/score_functions/EnvPairPotential/env_log.txt
basic.io.database: Database file opened: scoring/score_functions/EnvPairPotential/cbeta_den.txt
basic.io.database: Database file opened: scoring/score_functions/EnvPairPotential/pair_log.txt
basic.io.database: Database file opened: scoring/score_functions/EnvPairPotential/cenpack_log.txt
basic.io.database: Database file opened: scoring/score_functions/SecondaryStructurePotential/phi.theta.36.HS.resmooth
basic.io.database: Database file opened: scoring/score_functions/SecondaryStructurePotential/phi.theta.36.SS.resmooth
core.scoring: ATOM_VDW set to CENTROID_ROT
basic.io.database: Database file opened: scoring/score_functions/hbonds/sp2_elec_params/HBPoly1D.csv
basic.io.database: Database file opened: scoring/score_functions/hbonds/sp2_elec_params/HBFadeIntervals.csv
basic.io.database: Database file opened: scoring/score_functions/hbonds/sp2_elec_params/HBEval.csv
basic.io.database: Database file opened: scoring/score_functions/P_AA_pp/P_AA
basic.io.database: Database file opened: scoring/score_functions/P_AA_pp/P_AA_n
basic.io.database: Database file opened: scoring/score_functions/P_AA_pp/P_AA_pp
basic.io.database: Database file opened: scoring/score_functions/rama/Rama_smooth_dyn.dat_ss_6.4
basic.io.database: Database file opened: scoring/score_functions/centroid_smooth/cen_rot_pair_params.txt
basic.io.database: Database file opened: scoring/score_functions/centroid_smooth/cen_rot_env_params.txt
basic.io.database: Database file opened: scoring/score_functions/centroid_smooth/cen_rot_cbeta_params.txt
basic.io.database: Database file opened: scoring/score_functions/centroid_smooth/cen_rot_pair_ang_params.txt
core.scoring.CartesianBondedEnergy: Initializing IdealParametersDatabase with default Ks=300 , 80 , 20 , 10 , 40
basic.io.database: Database file opened: scoring/score_functions/bondlength_bondangle/default-lengths.txt
core.scoring.CartesianBondedEnergy: Read 770 bb-independent lengths.
basic.io.database: Database file opened: scoring/score_functions/bondlength_bondangle/default-angles.txt
core.scoring.CartesianBondedEnergy: Read 1464 bb-independent angles.
basic.io.database: Database file opened: scoring/score_functions/bondlength_bondangle/default-torsions.txt
core.scoring.CartesianBondedEnergy: Read 2127 bb-independent torsions.
core.scoring: ATOM_VDW set to CENTROID_ROT
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: talaris2013
core.scoring.etable: Starting energy table calculation
core.scoring.etable: smooth_etable: changing atr/rep split to bottom of energy well
core.scoring.etable: smooth_etable: spline smoothing lj etables (maxdis = 6)
core.scoring.etable: smooth_etable: spline smoothing solvation etables (max_dis = 6)
core.scoring.etable: Finished calculating energy tables.
protocols.jobdist.JobDistributors: Looking for an available job: 1 1  1
protocols.relax.ClassicRelax: Setting up default relax setting
protocols::checkpoint: Deleting checkpoints of ClassicRelax
protocols.abinitio:
===================================================================
   Stage 1                                                         
   Folding with score0 for max of 20000
protocols.abinitio: Replaced extended chain after 20 cycles.
protocols.moves.TrialCounter: ClassicFragmentM trials=     20;  accepts= 0.9000;  energy_drop/trial=   0.00413
protocols.abinitio: ------------------------------------------------------------
 Scores                       Weight   Raw Score Wghtd.Score
------------------------------------------------------------
 vdw                          0.100       0.826       0.083
---------------------------------------------------
 Total weighted score:                        0.083

Post Situation: 
Mon, 2015-10-05 13:20
samuelrpita

What was the format of the file you were passing as the "@" file?

It's not really "@data" but rather "@options", where the file specified after the @ symbol contains the same contents as the commandline options. It can be a little finiky, though. There's a nested format, but you have to be careful about indentation levels and not mixing tabs and spaces. Also, stray non-printing characters (e.g. Windows-style line endings) can also cause trouble.

Mon, 2015-10-05 13:44
rmoretti

Dear Rocco,

I'm used to work in Linux native machines (Ubuntu 14.0 LTS) and I'm using the vim editor to build all my files, including data. I guess the vim files was ASCII files. I'll check my data file to search about non-printing characters also.

Regards.

Mon, 2015-10-05 15:34
samuelrpita

Dear Rocco,

I'd checked my data file and the white spaces gave me the previous error message when I run Rosetta abinitio relax.

Thanks a lot!

Tue, 2015-10-06 08:58
samuelrpita

I am getting error while runnig this command : Rosetta/main/source/bin/AbinitioRelax.linuxgccrelease @flags

Flag :    -in:file:fasta ./input_files/1elwA.fasta

core.init: Rosetta version exported  from http://www.rosettacommons.org
core.init: command: rosetta/main/source/bin/AbinitioRelax.linuxgccrelease -in:file:fasta ./rosetta/demos/public/abinitio/input/1elwA.fasta
core.init: 'RNG device' seed mode, using '/dev/urandom', seed=620059290 seed_offset=0 real_seed=620059290
core.init.random: RandomGenerator:init: Normal mode, seed=620059290 RG_type=mt19937
core.init: Resolved executable path: /home/george/rosetta/main/source/build/src/release/linux/3.10/64/x86/gcc/4.8/static/AbinitioRelax.static.linuxgccrelease
core.init: Looking for database based on location of executable: /home/george/rosetta/main/database/
protocols.abinitio.AbrelaxApplication: read fasta sequence: 117 residues
EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR
protocols.evaluation.ChiWellRmsdEvaluatorCreator: Evaluation Creator active ...
core.chemical.ResidueTypeSet: Finished initializing centroid residue type set.  Created 1042 residue types
core.chemical.ResidueTypeSet: Total time to initialize 0.03 seconds.
ERROR: Value of inactive option accessed: -in:file:frag9

 

Mon, 2015-10-19 02:21
ashish.agrahari...

"Value of inactive option accessed" means that Rosetta tried to get (access) the value of an option, but it wasn't given on the commandline or the flags file (it's "inactive"). You would need to give an appropriate setting for the listed option (in this case, give the filename of an appropriate fragment file to -in:file:frag9).

Mon, 2015-10-19 14:32
rmoretti

Thank you for your reply, as you said in this case, I have to give the filename of an appropriate fragment file to -in:file:frag9. However i didn't  get which filename you are asking for and how to do that. if you will elaborate then it will be extremely helpfull for me.

below I am mentioning what exactaly I am doing :

I have created one directory of name test in desktop in that one more directory input_files where i have kept all input files that is given in demo input_files of rosetta, to run these  i am  using this command : "rosetta/main/source/bin/AbinitioRelax.linuxgccrelease -in:file:fasta ./Desktop/test/input_files/1elwA.fasta" as given instructions in read me file .

please let me know if I am doing anything wrong.

Thanking you.

 

Mon, 2015-10-19 23:03
ashish.agrahari...

Rosetta ab inito uses a "fragment insertion" based approach to build the structure of the protein. (If you haven't already, I strongly encourage you to read up on some of the published papers about it.) That is, using the sequence and predicted secondary structure of the protein you wish to model, you look through the PDB to find already existing proteins which are similar, at least over small regions. This is normally done for a number of different sized regions - typically 3 amino acid and 9 amino acid sized fragments. You then "borrow" the backbone conformations of those small existing protein regions, and assemble them to get a possible structure of your protein of interest. But you don't have just a single possibility for any small segment, instead you have a number of possibilities, and Rosetta tries multiple different combinations of them, guided by an scoring function to pick out the best one.

A key point from your perspective is that the search for existing protien fragments and the assembly into a single protein are split into separate phases. The AbinitioRelax.linuxgccrelease program handles the assembly and scoring phase. But to do this, it needs to have information about the fragments which match your sequence - that is, what parts of the existing PDBs should it combine together? It gets this information from fragment files.

The recommended way of obtaining fragment files (at least for academic users) is with the Robetta server (http://robetta.bakerlab.org/). Given a sequence, it will generate 3-mer and 9-mer fragment files. These generated files can them be passed to the AbinitioRelax.linuxgccrelease program using the approriate options, in addtion to the options which specify the fasta sequence you wish to model. 

These options can either be specified directly on the commandline, or Rosetta also has the ability to load the options from a text file, with the Rosetta-specific "@options_filename" syntax.

Tue, 2015-10-27 09:11
rmoretti